Skip to product information
1 of 1

Gene Bio Systems

Recombinant Synechocystis sp. Thylakoid membrane protein slr0575(slr0575)

Recombinant Synechocystis sp. Thylakoid membrane protein slr0575(slr0575)

SKU:CSB-CF706951SSQ

Regular price €1.469,95 EUR
Regular price Sale price €1.469,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Synechocystis sp. (strain PCC 6803 / Kazusa)

Uniprot NO.:Q55403

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLPKISLAAVGLTVGGILTITGFVAYALDYATLNLAGFFYGIPLVLGGLALKAAELKPIP FSQPTSEKIIALRNQLATPTQNQIRKDVTRYRYGQEAHLDESLERLGLSPTDEERPVLTS LLEQDWEGKYVLTLTFTSPFISLETWQEKQEKIAKFFGPDLEVTVAEPEEKVVTVNLISQ LALP

Protein Names:Recommended name: Thylakoid membrane protein slr0575

Gene Names:Ordered Locus Names:slr0575

Expression Region:1-184

Sequence Info:full length protein

View full details