Skip to product information
1 of 1

Gene Bio Systems

Recombinant Synechocystis sp. Probable diacylglycerol kinase(dgkA)

Recombinant Synechocystis sp. Probable diacylglycerol kinase(dgkA)

SKU:CSB-CF700954SSQ

Regular price €1.461,95 EUR
Regular price Sale price €1.461,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Synechocystis sp. (strain PCC 6803 / Kazusa)

Uniprot NO.:Q55143

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKSVYPMSSPSSAVFADQGLSGKANQTQPPPPLGLVVPASKPGAKKPLRKNAWQVAPNLL VSFRYAWAGVSYAFATQRNFRIHTFTGVAVITAASLLHLEAIAVAVLALTSCLVMILELL NTALESVVDLTVGQSYHELAKIAKDCAAGAVLLAAIAAVIVGGCLLLPPLLSLMV

Protein Names:Recommended name: Probable diacylglycerol kinase Short name= DAGK EC= 2.7.1.107 Alternative name(s): Diglyceride kinase Short name= DGK

Gene Names:Name:dgkA Ordered Locus Names:slr0054

Expression Region:1-175

Sequence Info:full length protein

View full details