Gene Bio Systems
Recombinant Synechococcus elongatus Photosystem I reaction center subunit XI(psaL)
Recombinant Synechococcus elongatus Photosystem I reaction center subunit XI(psaL)
SKU:CSB-CF310993FPY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Synechococcus elongatus (strain PCC 7942) (Anacystis nidulans R2)
Uniprot NO.:P95822
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAQDVIANGGTPEIGNLATPINSSPFTRTFINALPIYRRGLSSNRRGLEIGMAHGFLLYG PFSILGPLRNTETAGSAGLLATVGLVVILTVCLSLYGNAGSGPSAAESTVTTPNPPQELF TKEGWSEFTSGFILGGLGGAFFAFYLASTPYVQPLVKIAAGVWSVH
Protein Names:Recommended name: Photosystem I reaction center subunit XI Alternative name(s): PSI subunit V PSI-L
Gene Names:Name:psaL Ordered Locus Names:Synpcc7942_2342
Expression Region:1-166
Sequence Info:full length protein
