Skip to product information
1 of 1

Gene Bio Systems

Recombinant Surface presentation of antigens protein SpaQ(spaQ)

Recombinant Surface presentation of antigens protein SpaQ(spaQ)

SKU:CSB-CF358090SZB

Regular price €1.360,95 EUR
Regular price Sale price €1.360,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Shigella flexneri

Uniprot NO.:P0A1M4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSDIVYMGNKALYLILIFSLWPVGIATVIGLSIGLLQTVTQLQEQTLPFGIKLIGVSISL LLLSGWYGEVLLSFCHEIMFLIKSGV

Protein Names:Recommended name: Surface presentation of antigens protein SpaQ Alternative name(s): Protein spa9

Gene Names:Name:spaQ Synonyms:spa9 Ordered Locus Names:CP0154

Expression Region:1-86

Sequence Info:full length protein

View full details