Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sulfur-rich protein, serovars L1-L3(srp)

Recombinant Sulfur-rich protein, serovars L1-L3(srp)

SKU:CSB-CF324723DSA

Regular price €1.433,95 EUR
Regular price Sale price €1.433,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Chlamydia trachomatis

Uniprot NO.:P18587

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTVPVVQGAGSSNSAQDISTSSVPLTLQGRISNLLSSTAFKVGLVVMGLLLVMATIFLV SAASFVNPIYLAIPAIVGCVNICVGILSMEGYCSPERWSLCKKVLKASEDIIDDGQINNS NKVFTDERLNAIGGVVESLSRRNSLVDQTQ

Protein Names:Recommended name: Sulfur-rich protein, serovars L1/L3 Alternative name(s): 15 kDa cysteine-rich outer membrane protein Cysteine-rich protein A

Gene Names:Name:srp Synonyms:crpA

Expression Region:1-150

Sequence Info:full length protein

View full details