Gene Bio Systems
Recombinant Sulfur-rich protein, serovar C(srp)
Recombinant Sulfur-rich protein, serovar C(srp)
SKU:CSB-CF326659DSA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Chlamydia trachomatis
Uniprot NO.:P26756
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSTVPVVQGAGSSNSAQDISTSSAPLTLKERISNLLSSTAFKVGLVVIGLLLVIATLIFL VSAASFVNAIYLVAIPAILGCVNICVGILSMEGHCSPERWILCKKVLKTSEDIIDDGQIN NSNKVFTDERLNAIDGVVESLSRRNSLVDQTQ
Protein Names:Recommended name: Sulfur-rich protein, serovar C Alternative name(s): 15 kDa cysteine-rich outer membrane protein Cysteine-rich protein A
Gene Names:Name:srp Synonyms:crpA
Expression Region:1-152
Sequence Info:full length protein
