Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sulfoxide reductase heme-binding subunit YedZ(yedZ)

Recombinant Sulfoxide reductase heme-binding subunit YedZ(yedZ)

SKU:CSB-CF371818EJE

Regular price €1.491,95 EUR
Regular price Sale price €1.491,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Escherichia coli O1:K1 / APEC

Uniprot NO.:A1ACB7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRLTAKQVTWLKVCLHLAGLLPFLWLAWAINHGGLGADPVKDIQHFTGRTALKFLLATLL ITPLARYAKQPLLIRTRRLLGLWCFAWATLHLTSYALLELGVNNLALLGKELITRPYLTL GIISWVILLALAFTSTQAMQRKLGKHWQQLHNFVYLVAILAPIHYLWSVKIISPQPLIYA GLAVLLLALRYKKLLSLFNQLRKQVHNKLSL

Protein Names:Recommended name: Sulfoxide reductase heme-binding subunit YedZ Alternative name(s): Flavocytochrome YedZ

Gene Names:Name:yedZ Ordered Locus Names:Ecok1_18130 ORF Names:APECO1_1007

Expression Region:1-211

Sequence Info:full length protein

View full details