Gene Bio Systems
Recombinant Structural protein VP1(VP1)
Recombinant Structural protein VP1(VP1)
SKU:CSB-CF324019SRM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sulfolobus virus-like particle SSV1
Uniprot NO.:P20223
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:EATNIGVLLGLFIFILIGIVLLPVIVSQVNNLTSGTSPQVTGTNATLLNLVPLFYILVLI IVPAVVAYKIYKD
Protein Names:Recommended name: Structural protein VP1
Gene Names:Name:VP1
Expression Region:72-144
Sequence Info:full length protein
