Gene Bio Systems
Recombinant Strongylocentrotus purpuratus NADH-ubiquinone oxidoreductase chain 4L(ND4L)
Recombinant Strongylocentrotus purpuratus NADH-ubiquinone oxidoreductase chain 4L(ND4L)
SKU:CSB-CF015080FOT-GB
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Strongylocentrotus purpuratus (Purple sea urchin)
Uniprot NO.:P15554
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MALLIVILSMFYLGLMGILLNRLHFLSILLCLELLLISLFIGIAIWNNNTGVPQNTTFNL FVLTLVACEASIGLSLMVGLSRTHSSNLVGSLSLLQY
Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 4L EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 4L
Gene Names:Name:ND4L
Expression Region:1-97
Sequence Info:full length protein
