Skip to product information
1 of 1

Gene Bio Systems

Recombinant Streptomyces coelicolor UPF0126 membrane protein SCO5481 (SCO5481)

Recombinant Streptomyces coelicolor UPF0126 membrane protein SCO5481 (SCO5481)

SKU:CSB-CF527086FOB

Regular price €1.497,95 EUR
Regular price Sale price €1.497,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

Uniprot NO.:O86576

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MYEQLFSPTVQHTLDLVGIFVFAISGALLAVRKNFDVFGIAVLAEVTALGGGLFRDLVIG AVPPAAFTDLGYFLTPLLATLLVFFLHPHVERLQTGVNIFDAAGLGLFCVAGTTKAYDYG LGLTASACLGLTTAVGGGVLRDVLANEVPSLLRWDRDLYAVPAIVGSAMVALCIRYEALT PFTSGLAVVTAFVLRLLALRFHWRAPRAWNRRSTVVEGD

Protein Names:Recommended name: UPF0126 membrane protein SCO5481

Gene Names:Ordered Locus Names:SCO5481 ORF Names:SC2A11.15

Expression Region:1-219

Sequence Info:full length protein

View full details