Gene Bio Systems
Recombinant Staphylothermus marinus UPF0290 protein Smar_0617 (Smar_0617)
Recombinant Staphylothermus marinus UPF0290 protein Smar_0617 (Smar_0617)
SKU:CSB-CF385224SUP
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / F1)
Uniprot NO.:A3DM64
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSGYMISPEYYFIYWFLKYYLSPMIANASPVLVKGIHRIDFSHIFIDGKPLFGKNKTWEG FYVGVLMGFLTSIGIGIILCEEEYILIGLGSSIFALIGDLLGSFIKRRMNIASGEPLPII DQLDFALMATLYYYFLGIEEFISYPLYILYSLIIILALHIITNNIAYYLGVKDKRW
Protein Names:Recommended name: UPF0290 protein Smar_0617
Gene Names:Ordered Locus Names:Smar_0617
Expression Region:1-176
Sequence Info:full length protein
