Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus epidermidis Na(+)-H(+) antiporter subunit C1(mnhC1)

Recombinant Staphylococcus epidermidis Na(+)-H(+) antiporter subunit C1(mnhC1)

SKU:CSB-CF702342SAAA

Regular price €1.243,95 EUR
Regular price Sale price €1.243,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Uniprot NO.:Q5HQL2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEIIMIFVSGILTSISVYLVLSKSLIRIIMGTTLLTHAANLFLITMGGLKHGTVPIFEKG TSSYVDPIPQALILTAIVIAFATTAFFLVLAFRTYKELGTDNVELMKGAPEDDRE

Protein Names:Recommended name: Na(+)/H(+) antiporter subunit C1 Alternative name(s): Mnh complex subunit C1

Gene Names:Name:mnhC1 Ordered Locus Names:SERP0536

Expression Region:1-115

Sequence Info:full length protein

View full details