Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus UPF0382 membrane protein SAR0588(SAR0588)

Recombinant Staphylococcus aureus UPF0382 membrane protein SAR0588(SAR0588)

SKU:CSB-CF750155SKV

Regular price €1.404,95 EUR
Regular price Sale price €1.404,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain MRSA252)

Uniprot NO.:Q6GJ86

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKLFIILGALNAMMAVGTGAFGAHGLQGKISDHYLSVWEKATTYQMYHGLALLIIGVISG TTSINVNWAGWLIFAGIIFFSGSLYILVLTQIKVLGAITPIGGVLFIIGWIMLIIATFKF AG

Protein Names:Recommended name: UPF0382 membrane protein SAR0588

Gene Names:Ordered Locus Names:SAR0588

Expression Region:1-122

Sequence Info:full length protein

View full details