Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus UPF0316 protein SAUSA300_1892(SAUSA300_1892)

Recombinant Staphylococcus aureus UPF0316 protein SAUSA300_1892(SAUSA300_1892)

SKU:CSB-CF639166SKZ

Regular price €1.488,95 EUR
Regular price Sale price €1.488,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain USA300)

Uniprot NO.:Q2FFI4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFVTENPWLMVLTIFIINICYVTFLTMRTILTLKGYRYIAASVSFLEVLVYIVGLGLVM SNLDHIQNIIAYAFGFSIGIIVGMKIEEKLALGYTVVNVTSAEYELDLPNELRNLGYGVT HYAAFGRDGSRMVMQILTPRKYERKLMDTIKNLDPKAFIIAYEPRNIHGGFWTKGIRRRK LKDYEPEELESVVEHEIQSK

Protein Names:Recommended name: UPF0316 protein SAUSA300_1892

Gene Names:Ordered Locus Names:SAUSA300_1892

Expression Region:1-200

Sequence Info:full length protein

View full details