
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q99SU9
Gene Names: scn
Organism: Staphylococcus aureus (strain N315)
AA Sequence: STSLPTSNEYQNEKLANELKSLLDELNVNELATGSLNTYYKRTIKISGLKAMYALKSKDFKKMSEAKYQLQKIYNEIDEALKSKY
Expression Region: 32-116aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 25.8 kDa
Alternative Name(s): SCIN
Relevance: Involved in countering the first line of host defense mechanisms. Efficiently inhibits opsonization, phagocytosis and killing of S.aureus by human neutrophils. Acts by binding and stabilizing human C3 convertases (C4b2a and C3bBb), leading to their inactivation. The convertases are no longer able to cleave complement C3, therefore preventing further C3b deposition on the bacterial surface and phagocytosis of the bacterium. Also prevents C5a-induced neutrophil responses (By similarity).
Reference: "Whole genome sequencing of meticillin-resistant Staphylococcus aureus."Kuroda M., Ohta T., Uchiyama I., Baba T., Yuzawa H., Kobayashi I., Cui L., Oguchi A., Aoki K., Nagai Y., Lian J.-Q., Ito T., Kanamori M., Matsumaru H., Maruyama A., Murakami H., Hosoyama A., Mizutani-Ui Y. Hiramatsu K.Lancet 357:1225-1240(2001)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Staphylococcus aureus Staphylococcal complement inhibitor(scn)
- Regular price
- €722,95 EUR
- Sale price
- €722,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Acyl carrier protein(acpP)
- Regular price
- €820,95 EUR
- Sale price
- €820,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Acyl carrier protein(acpP)
- Regular price
- €820,95 EUR
- Sale price
- €820,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Acyl carrier protein(acpP),partial
- Regular price
- €747,95 EUR
- Sale price
- €747,95 EUR
- Regular price
-
- Unit price
- per
Sold out