Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus Putative antiporter subunit mnhE2(mnhE2)

Recombinant Staphylococcus aureus Putative antiporter subunit mnhE2(mnhE2)

SKU:CSB-CF409922FLG

Regular price €1.443,95 EUR
Regular price Sale price €1.443,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain Newman)

Uniprot NO.:A6QET7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNQIVLNIIIAFLWVLFQDEDHFKFSTFFSGYLIGLIVIYILHRFFSDDFYVRKIWVAIK FLGVYLYQLITSSISTINYILFKTKDMNPGLLSYETRLTSDWSITFLTILIIITPGSTVI RISQDSKKFFIHSIDVSEKEKDSLLRSIKHYEDLILEVSR

Protein Names:Recommended name: Putative antiporter subunit mnhE2 Alternative name(s): Mrp complex subunit E2 Putative NADH-ubiquinone oxidoreductase subunit mnhE2

Gene Names:Name:mnhE2 Synonyms:mrpE2 Ordered Locus Names:NWMN_0597

Expression Region:1-160

Sequence Info:full length protein

View full details