Recombinant Staphylococcus aureus Phospholipase C(hlb)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Staphylococcus aureus Phospholipase C(hlb)

CSB-YP357824FKZb0
Regular price
€825,95 EUR
Sale price
€825,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P09978

Gene Names: hlb

Organism: Staphylococcus aureus (strain MRSA252)

AA Sequence: ESKKDDTDLKLVSHNVYMLSTVLYPNWGQYKRADLIGQSSYIKNNDVVIFNEAFDNGASDKLLSNVKKEYPYQTPVLGRSQSGWDKTEGSYSSTVAEDGGVAIVSKYPIKEKIQHVFKSGCGFDNDSNKGFVYTKIEKNGKNVHVIGTHTQSEDSRCGAGHDRKIRAEQMKEISDFVKKKNIPKDETVYIGGDLNVNKGTPEFKDMLKNLNVNDVLYAGHNSTWDPQSNSIAKYNYPNGKPEHLDYIFTDKDHKQPKQLVNEVVTEKPKPWDVYAFPYYYVYNDFSDHYPIKAYSK

Expression Region: 35-330aa

Sequence Info: Full Length of Mature Protein

Source: Yeast

Tag Info: N-terminal 10xHis-tagged

MW: 36.2 kDa

Alternative Name(s): Beta-hemolysin Beta-toxin Sphingomyelinase

Relevance: Bacterial hemolysins are exotoxins that attack blood cell membranes and cause cell rupture. Beta-hemolysin is a phospholipase C with specific activity toward sphingomyelins. Has a high specificity for sphingomyelin, hydrolyzes lysophosphatidylcholine at a much lower rate, but has no activity towards phosphatidylcholine, phosphatidylethanolamine, or phosphatidylserine

Reference: "Insertional inactivation of the Staphylococcus aureus beta-toxin by bacteriophage phi 13 occurs by site- and orientation-specific integration of the phi 13 genome." Coleman D., Knights J., Russell R., Shanley D., Birkbeck T.H., Dougan G., Charles I. Mol. Microbiol. 5:933-939(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Staphylococcus aureus Phospholipase C(hlb)
    Regular price
    €726,95 EUR
    Sale price
    €726,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Staphylococcus aureus Phospholipase C(hlb)
    Regular price
    €726,95 EUR
    Sale price
    €726,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Staphylococcus aureus Alpha-hemolysin(hly)
    Regular price
    €825,95 EUR
    Sale price
    €825,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Staphylococcus aureus Gamma-hemolysin component C (hlgC)
    Regular price
    €600,95 EUR
    Sale price
    €600,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share