Gene Bio Systems
Recombinant Staphylococcus aureus Leukocidin-F subunit(lukF)
Recombinant Staphylococcus aureus Leukocidin-F subunit(lukF)
SKU:CSB-EP330106FKZ
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P31715
Gene Names: lukF
Organism: Staphylococcus aureus
AA Sequence: AEGKITPVSVKKVDDKVTLYKTTATADSDKFKISQILTFNFIKDKSYDKDTLVLKATGNINSGFVKPNPNDYDFSKLYWGAKYNVSISSQSNDSVNAVDYAPKNQNEEFQVQNTLGYTFGGDISISNGLSGGLNGNTAFSETINYKQESYRTLSRNTNYKNVGWGVEAHKIMNGWGPYGRDSFHPTYGNELFLAGRQSSAYAGQNFIAQHQMPLLSRSNFNPEFLSVLSHRQDRAKKSKITVTYQREMDLYQIRWNGFYWAGANYKNFKTRTFKSTYEIDWENHKVKLLDTKETENNK
Expression Region: 26-323aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW: 54 kDa
Alternative Name(s): Gamma-hemolysin, H-gamma-I subunit
Relevance: Leukocidin causes cytotoxic changes in polymorphonuclear leukocytes. Gamma-hemolysin causes hemolysis in red blood cells.
Reference: "The two Staphylococcal bi-component toxins, leukocidin and gamma-hemolysin, share one component in common." Kamio Y., Rahman A., Nariya H., Ozawa T., Izaki K. FEBS Lett. 321:15-18(1993)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
