Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus Enterotoxin type C-2(entC2)

Recombinant Staphylococcus aureus Enterotoxin type C-2(entC2)

SKU:CSB-EP339410FKZe1

Regular price €870,95 EUR
Regular price Sale price €870,95 EUR
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein: entC2

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Staphylococcus aureus

Delivery time: 3-7 business days

Uniprot ID: P34071

AA Sequence: ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG

Tag info: NO-tagged

Expression Region: 28-266aa

Protein length: Full Length

MW: 27.6 kDa

Alternative Name(s): SEC2

Relevance: Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death.

Reference: "Conservation of the biologically active portions of staphylococcal enterotoxins C1 and C2." Bohach G.A., Schlievert P.M. Infect. Immun. 57:2249-2252(1989)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details