Recombinant Staphylococcus aureus Clumping factor A(clfA) ,partial

Recombinant Staphylococcus aureus Clumping factor A(clfA) ,partial

CSB-EP692021FLB
Regular price
€914,95 EUR
Sale price
€914,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Microbiology

Target / Protein: clfA

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Staphylococcus aureus (strain COL)

Delivery time: 3-7 business days

Uniprot ID: Q5HHM8

AA Sequence: GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 229-559aa

Protein length: Partial

MW: 52 kDa

Alternative Name(s): Fibrinogen receptor A Fibrinogen-binding protein A

Relevance: Cell surface-associated protein implicated in virulence. Promotes bacterial attachment exclusively to the gamma-chain of human fibrinogen. Induces formation of bacterial clumps (By similarity)

Reference: "Insights on evolution of virulence and resistance from the complete genome analysis of an early methicillin-resistant Staphylococcus aureus strain and a biofilm-producing methicillin-resistant Staphylococcus epidermidis strain."Gill S.R., Fouts D.E., Archer G.L., Mongodin E.F., DeBoy R.T., Ravel J., Paulsen I.T., Kolonay J.F., Brinkac L.M., Beanan M.J., Dodson R.J., Daugherty S.C., Madupu R., Angiuoli S.V., Durkin A.S., Haft D.H., Vamathevan J.J., Khouri H. Fraser C.M.J. Bacteriol. 187:2426-2438(2005)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Staphylococcus aureus Clumping factor A(clfA) ,partial
    Regular price
    €914,95 EUR
    Sale price
    €914,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Staphylococcus aureus Clumping factor A(clfA),partial
    Regular price
    €1.003,95 EUR
    Sale price
    €1.003,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Staphylococcus aureus Clumping factor A(clfA)
    Regular price
    €783,95 EUR
    Sale price
    €783,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Staphylococcus aureus Clumping factor A(clfA),partial
    Regular price
    €1.003,95 EUR
    Sale price
    €1.003,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share