
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Staphylococcus aureus (strain COL)
Uniprot NO.:Q5HCN3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKEKFDLVKLLNILKKNIKLLLILPAICLVVSAALTFFVMPDKYTASTQILVNMKKSSSD LAFQNVQSSLQSVNTYTEIIKSPRILDKVSREFDGQYSTAELNSFLKVTNQTNSQIITVS VTTGNKSESDKIVNKISKVFAHDMPKIMSVDNVTILSSAHDNAVKVSPIVSVNLVISIIV GIVLAILIIFLKELLDKRIKTEEDVESQLGLPILGSIQKF
Protein Names:Recommended name: Capsular polysaccharide biosynthesis protein CapA
Gene Names:Name:capA Synonyms:cap1A Ordered Locus Names:SACOL2687
Expression Region:1-220
Sequence Info:full length protein
You may also like
-
Recombinant Staphylococcus aureus Capsular polysaccharide biosynthesis protein CapA(capA)
- Regular price
- €1.106,95 EUR
- Sale price
- €1.106,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Capsular polysaccharide biosynthesis protein CapA(capA)
- Regular price
- €1.106,95 EUR
- Sale price
- €1.106,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Capsular polysaccharide biosynthesis protein CapA(capA)
- Regular price
- €1.106,95 EUR
- Sale price
- €1.106,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Staphylococcus aureus Capsular polysaccharide biosynthesis protein CapA(capA)
- Regular price
- €1.106,95 EUR
- Sale price
- €1.106,95 EUR
- Regular price
-
- Unit price
- per
Sold out