Skip to product information
1 of 1

Gene Bio Systems

Recombinant Staphylococcus aureus 30KDA neutral phosphatase

Recombinant Staphylococcus aureus 30KDA neutral phosphatase

SKU:CSB-EP324148FKZ

Regular price €1.021,95 EUR
Regular price Sale price €1.021,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Microbiology

Uniprot ID: P21222

Gene Names: N/A

Organism: Staphylococcus aureus

AA Sequence: KSSAEVQQTQQASIPASQKANLGNQNNIMSVASYQ

Expression Region: 1-35aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 19.7 kDa

Alternative Name(s): Short name:NPTase

Relevance: Highly cationic enzyme that can bind human or rat immunoglobulins as well as serum albumin, and could therefore be involved in post-infectious sequelae.

Reference: "Staphylococcal neutral phosphatase. A highly cationic molecule with binding properties for immunoglobulin."Yousif Y., Schiltz E., Okada K., Batsford S., Vogt A.APMIS 102:891-900(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details