Gene Bio Systems
Recombinant Spiroplasma virus SpV1-R8A2 B Uncharacterized protein ORF7 (ORF7)
Recombinant Spiroplasma virus SpV1-R8A2 B Uncharacterized protein ORF7 (ORF7)
SKU:CSB-CF325788SJZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Spiroplasma virus SpV1-R8A2 B (SpV1) (Spiroplasma virus 1)
Uniprot NO.:P15898
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLGMYLTTAFNFLTASTPKTMSEGMTGIWTGLSSALWKVKEGITNILPEIMVFLGEAWII LIPFAIFCIIKILNFFRVMVKGF
Protein Names:Recommended name: Uncharacterized protein ORF7 Alternative name(s): Gene 7 protein
Gene Names:ORF Names:ORF7
Expression Region:1-83
Sequence Info:full length protein
