Gene Bio Systems
Recombinant Sphingomonas wittichii Large-conductance mechanosensitive channel(mscL)
Recombinant Sphingomonas wittichii Large-conductance mechanosensitive channel(mscL)
SKU:CSB-CF404989SUF
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)
Uniprot NO.:A5VBY5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLQDFKAFINKGNVVDLAVAVIIGAAFGKIVSSLTDDLIMPLIGYFTGGLDFSSHFIRLG EIPANFTGSVTSYADLKNAGVPLIGFGQFITVAVNFLLIAFVVFLVVRAVQRFNKAEEAK PAEPAEDVVLLREILAELKKKG
Protein Names:Recommended name: Large-conductance mechanosensitive channel
Gene Names:Name:mscL Ordered Locus Names:Swit_3455
Expression Region:1-142
Sequence Info:full length protein
