Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sorangium cellulosum UPF0059 membrane protein sce0548 (sce0548)

Recombinant Sorangium cellulosum UPF0059 membrane protein sce0548 (sce0548)

SKU:CSB-CF433584SUD

Regular price €1.468,95 EUR
Regular price Sale price €1.468,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Sorangium cellulosum (strain So ce56) (Polyangium cellulosum (strain So ce56))

Uniprot NO.:A9GV45

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNFSAILLLALGLAMDATAVAAARGLSVPAIRARHVLLVAGFFGGAQALMPVIGWLLGAR IGPRVQAWDHWIAFVLLAFIGGKMLWEARGDGGDDGGEGETTADPFALSAMFVLAIATSI DALAVGITLPMLNAPFAISVVTIGVVTALLSAAGLFAGRRFGALLGKRLDLAGGVVLIGL GFKILLEHLVLS

Protein Names:Recommended name: UPF0059 membrane protein sce0548

Gene Names:Ordered Locus Names:sce0548

Expression Region:1-192

Sequence Info:full length protein

View full details