
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Solanum lycopersicum (Tomato) (Lycopersicon esculentum)
Uniprot NO.:P10707
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:SLVHAQSILAIWACQVVLMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAEL KVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK
Protein Names:Recommended name: Chlorophyll a-b binding protein 1D Alternative name(s): LHCII type I CAB-1D Short name= LHCP
Gene Names:Name:CAB1D
Expression Region:1-116
Sequence Info:full length protein
You may also like
-
Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 1B, chloroplastic(CAB1B)
- Regular price
- €1.107,95 EUR
- Sale price
- €1.107,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 1A, chloroplastic(CAB1A)
- Regular price
- €1.108,95 EUR
- Sale price
- €1.108,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 1C, chloroplastic(CAB1C)
- Regular price
- €1.108,95 EUR
- Sale price
- €1.108,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Solanum lycopersicum Chlorophyll a-b binding protein 3C, chloroplastic(CAB3C)
- Regular price
- €1.109,95 EUR
- Sale price
- €1.109,95 EUR
- Regular price
-
- Unit price
- per
Sold out