Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sodalis glossinidius UPF0059 membrane protein SG1323(SG1323)

Recombinant Sodalis glossinidius UPF0059 membrane protein SG1323(SG1323)

SKU:CSB-CF652298SBAA

Regular price €1.471,95 EUR
Regular price Sale price €1.471,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Sodalis glossinidius (strain morsitans)

Uniprot NO.:Q2NTC7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLSATLILAFGMSMDAFAASVGKGATLHKPALREALRTGLIFGVIEAITPLIGWGLGLL SSQYIMRWDHWVAFTLLAFLGGRMVLAGWKQQPLETSLVGKHSLGVLIATAIATSLDALA IGVGLAMLQVNILHAALLIGLATLIMSTIGMLLGRFVGPCLGSKAEIIGGLILIGIGCNI LYSHIGEAMLAHLPG

Protein Names:Recommended name: UPF0059 membrane protein SG1323

Gene Names:Ordered Locus Names:SG1323

Expression Region:1-195

Sequence Info:full length protein

View full details