Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sinapis alba Chlorophyll a-b binding protein 1, chloroplastic(CAB1)

Recombinant Sinapis alba Chlorophyll a-b binding protein 1, chloroplastic(CAB1)

SKU:CSB-CF319602SZO

Regular price €1.515,95 EUR
Regular price Sale price €1.515,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sinapis alba (White mustard) (Brassica hirta)

Uniprot NO.:P13851

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RKTVKPTGPSGSPWYGSDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNR ELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQ SILAIWATQVILMGAVEGYRVAGEGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKEI KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK

Protein Names:Recommended name: Chlorophyll a-b binding protein 1, chloroplastic Alternative name(s): LHCII type I CAB-1 Short name= LHCP

Gene Names:Name:CAB1

Expression Region:36-266

Sequence Info:full length protein

View full details