Skip to product information
1 of 1

Gene Bio Systems

Recombinant Shewanella sp. Probable intracellular septation protein A(Shewmr7_1515)

Recombinant Shewanella sp. Probable intracellular septation protein A(Shewmr7_1515)

SKU:CSB-CF607866SAAO

Regular price €1.465,95 EUR
Regular price Sale price €1.465,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Shewanella sp. (strain MR-7)

Uniprot NO.:Q0HWJ2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKQLLDFLPLIIFFAVYKFFDIYIASGALIAATALQLVVTYALYKKLEKMHLITFAMVTV FGTLTLVFHDDAFIKWKVTIIYALFALALGVSQLLNKSILKSMLGKEMKVADNIWAHVTW YWVSFFAICGLVNIYVAFRLPLETWVNFKVFGLTALTLINTVITVFYLYKHLPEDQRKEL K

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:Shewmr7_1515

Expression Region:1-181

Sequence Info:full length protein

View full details