Skip to product information
1 of 1

Gene Bio Systems

Recombinant Shewanella sp. Large-conductance mechanosensitive channel(mscL)

Recombinant Shewanella sp. Large-conductance mechanosensitive channel(mscL)

SKU:CSB-CF605020SAAN

Regular price €1.419,95 EUR
Regular price Sale price €1.419,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Shewanella sp. (strain MR-4)

Uniprot NO.:Q0HMW6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSLIKEFKAFASRGNVIDMAVGIIIGAAFGKIVSSFVADIIMPPIGIILGGVNFSDLSIV LQAAQGDAPAVVIAYGKFIQTVIDFTIIAFAIFMGLKAINSLKRKQEEAPKAPPAPTKDQ ELLSEIRDLLKAQQEK

Protein Names:Recommended name: Large-conductance mechanosensitive channel

Gene Names:Name:mscL Ordered Locus Names:Shewmr4_0521

Expression Region:1-136

Sequence Info:full length protein

View full details