Skip to product information
1 of 1

Gene Bio Systems

Recombinant Shewanella putrefaciens Electron transport complex protein RnfA(rnfA)

Recombinant Shewanella putrefaciens Electron transport complex protein RnfA(rnfA)

SKU:CSB-CF397191STQ

Regular price €1.469,95 EUR
Regular price Sale price €1.469,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)

Uniprot NO.:A4Y6J0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTEYLLLLISTVLVNNFVLVKFLGLCPFMGVSSKLESAIGMSMATTFVLTLASILSYLVN QYLLLPFDLSYLRTMSFILVIAVVVQFTEMVVQKTSAALHRALGIYLPLITTNCAVLGVA LLNVNEKHDFIQSAIYGFGAAVGFSLVLILFSAMRERLAAADVPLPFKGGAIAMITAGLM SLAFMGFTGLVK

Protein Names:Recommended name: Electron transport complex protein RnfA

Gene Names:Name:rnfA Ordered Locus Names:Sputcn32_1850

Expression Region:1-192

Sequence Info:full length protein

View full details