Gene Bio Systems
Recombinant Shewanella denitrificans UPF0114 protein Sden_0436(Sden_0436)
Recombinant Shewanella denitrificans UPF0114 protein Sden_0436(Sden_0436)
SKU:CSB-CF623739SAAQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Uniprot NO.:Q12S48
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEKVFEKLMYASRWIMAPIYLGLSLILFALGIKFFQEIFHLIPNIFEIAEVDLVLITLSL IDITLVGGLLIMVMFSGYENFVSQLDVGESSEKLNWLGKMDAGSLKNKVAASIVAISSIH LLKVFMNAENIANDKIMWYLLIHITFVLSAFAMGYLDKITRK
Protein Names:Recommended name: UPF0114 protein Sden_0436
Gene Names:Ordered Locus Names:Sden_0436
Expression Region:1-162
Sequence Info:full length protein
