Skip to product information
1 of 1

Gene Bio Systems

Recombinant Shewanella baltica Protein CrcB homolog(crcB)

Recombinant Shewanella baltica Protein CrcB homolog(crcB)

SKU:CSB-CF408911STM

Regular price €1.411,95 EUR
Regular price Sale price €1.411,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Shewanella baltica (strain OS185)

Uniprot NO.:A6WNG2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNNLLLVALGGSIGAVFRYLISIFMIQVFGSSFPFGTLLVNVLGSFLMGVIYALGQMSHI SPELKALIGIGLLGALTTFSTFSNETLLLLQEGDWLKATLNVVLNLSLCLFMVYLGQQLV FSRI

Protein Names:Recommended name: Protein CrcB homolog

Gene Names:Name:crcB Ordered Locus Names:Shew185_2212

Expression Region:1-124

Sequence Info:full length protein

View full details