Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sheep Proteolipid protein 2(PLP2)

Recombinant Sheep Proteolipid protein 2(PLP2)

SKU:CSB-CF635698SH

Regular price €1.210,95 EUR
Regular price Sale price €1.210,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ovis aries (Sheep)

Uniprot NO.:Q28597

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ISGPWSDFFRALGAVILYLMTSIVVLVERGNNSKGAAGVLGLCAAGLFGYDAYITFPSGT RRHTAAPTDPADGPVR

Protein Names:Recommended name: Proteolipid protein 2 Alternative name(s): Differentiation-dependent protein A4 Intestinal membrane A4 protein

Gene Names:Name:PLP2 Synonyms:A4

Expression Region:1-76

Sequence Info:full length protein

View full details