Skip to product information
1 of 1

Gene Bio Systems

Recombinant Sheep Kit ligand(KITLG)

Recombinant Sheep Kit ligand(KITLG)

SKU:CSB-CF012376SH

Regular price €1.522,95 EUR
Regular price Sale price €1.522,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Ovis aries (Sheep)

Uniprot NO.:P79368

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QGICRNRVTDDVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVEQLSVSLTDLL DKFSNISEGLSNYSIIDKLVKIVDDLVECMEEHSFENVKKSSKSPEPRQFTPEKFFGIFN KSIDAFKDLEIVASTMSECVISSTSSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKA SNSIEDSSLQWAAVALPAFFSLVIGFAFGALYWKKKQPNLTRTVENRQINEEDNEISMLQ EK

Protein Names:Recommended name: Kit ligand Alternative name(s): Mast cell growth factor Short name= MGF Stem cell factor Short name= SCF c-Kit ligand Cleaved into the following chain: 1. Soluble KIT ligand Short name= 2. sKITLG

Gene Names:Name:KITLG Synonyms:SCF

Expression Region:26-267

Sequence Info:full length protein

View full details