Gene Bio Systems
Recombinant Sheep Interleukin-1 beta(IL1B)
Recombinant Sheep Interleukin-1 beta(IL1B)
SKU:CSB-YP011614SH
Couldn't load pickup availability
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: Others
Target / Protein: IL1B
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Ovis aries (Sheep)
Delivery time: 3-7 business days
Uniprot ID: P21621
AA Sequence: AAVQSVKCKLQDREQKSLVLDSPCVLKALHLPSQEMSREVVFCMSFVQGEERDNKIPVALGIRDKNLYLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQIEEKPVFLGRFRGGQDITDFRMETLSP
Tag info: N-terminal 6xHis-tagged
Expression Region: 114-266aa
Protein length: Full Length of Mature Protein
MW: 19.7 kDa
Alternative Name(s):
Relevance: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Reference: Nucleotide sequence of ovine interleukin-1 beta.Fiskerstrand C., Sargan D.Nucleic Acids Res. 18:7165-7165(1990)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
