Skip to product information
1 of 1

GeneBio Systems

Recombinant Sesamum indicum 11S globulin seed storage protein 2, partial

Recombinant Sesamum indicum 11S globulin seed storage protein 2, partial

SKU:Q9XHP0

Regular price €844,95 EUR
Regular price Sale price €844,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size: 100ug. Other sizes are also available.

Activity: Not tested

Research Areas: Others

Uniprot ID: Q9XHP0

Gene Names: N/A

Alternative Name(s): (11S globulin Ses i 6)(11S globulin seed storage protein II)(Allergen Ses i 6)(Alpha-globulin)(allergen Ses i 6.0101)

Abbreviation: Recombinant Sesamum indicum 11S globulin seed storage protein 2 protein, partial

Organism: Sesamum indicum (Oriental sesame) (Sesamum orientale)

Source: E.coli

Expression Region: 22-277aa

Protein Length: Partial

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein Sequence: QTREPRLTQGQQCRFQRISGAQPSLRIQSEGGTTELWDERQEQFQCAGIVAMRSTIRPNGLSLPNYHPSPRLVYIERGQGLISIMVPGCAETYQVHRSQRTMERTEASEQQDRGSVRDLHQKVHRLRQGDIVAIPSGAAHWCYNDGSEDLVAVSINDVNHLSNQLDQKFRAFYLAGGVPRSGEQEQQARQTFHNIFRAFDAELLSEAFNVPQETIRRMQSEEEERGLIVMARERMTFVRPDEEEGEQEHRGRQLDN

MW: 36.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Endotoxin: Not test

Biological_Activity:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Relevance: Seed storage protein.

Reference: "Ses i 6, the sesame 11S globulin, can activate basophils and shows cross-reactivity with walnut in vitro." Wallowitz M.L., Chen R.J., Tzen J.T., Teuber S.S. Clin. Exp. Allergy 37: 929-938(2007)

Function:

View full details