Gene Bio Systems
Recombinant Serratia proteamaculans UPF0208 membrane protein Spro_3315 (Spro_3315)
Recombinant Serratia proteamaculans UPF0208 membrane protein Spro_3315 (Spro_3315)
SKU:CSB-CF423639STJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Serratia proteamaculans (strain 568)
Uniprot NO.:A8GH23
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTSKPSGSVSWFQVFQRGQHYMKTWPSDKRLAPVFPENRVASATRFAVRFMPPLAVFTLT WQIALGGQLGPAIATALFACSMPMQGLWWLGRRSVTPLPPTLLQWFHEVRNKLAEAGQAV APVEGTPTYQALADLLKRAFKQLDKTFLDDL
Protein Names:Recommended name: UPF0208 membrane protein Spro_3315
Gene Names:Ordered Locus Names:Spro_3315
Expression Region:1-151
Sequence Info:full length protein
