
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:O59776
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MYRPTTTSYSPVYTGNPLYDISASQSDPRQRIRKNVRFQTEVDEFPDFDDSDSDELQFEN RDPRKRIDPIKHMLLVQRLKRVSTSSRRLFIFTLSMFLIAFILLIAFVSFRD
Protein Names:Recommended name: Uncharacterized protein C1795.12c
Gene Names:ORF Names:SPCC1795.12c
Expression Region:1-112
Sequence Info:full length protein
You may also like
-
Recombinant Schizosaccharomyces pombe Uncharacterized protein C3H7.08c (SPBC3H7.08c)
- Regular price
- €1.033,95 EUR
- Sale price
- €1.033,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Schizosaccharomyces pombe Uncharacterized protein C1002.01(SPAC1002.01, SPAC1610.05)
- Regular price
- €1.076,95 EUR
- Sale price
- €1.076,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Schizosaccharomyces pombe Uncharacterized protein C1739.04c (SPCC1739.04c)
- Regular price
- €1.158,95 EUR
- Sale price
- €1.158,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Schizosaccharomyces pombe Uncharacterized protein C2C4.05 (SPAC2C4.05)
- Regular price
- €1.043,95 EUR
- Sale price
- €1.043,95 EUR
- Regular price
-
- Unit price
- per
Sold out