
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:O13809
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSSSTYRKLPKILAAGLAIGCAGGYYAYKNSNKPPGLNPEIYAPFTVNKITELTSDASLF SLVPQSPSEHLTTLEPIAKVTIRDPSMQVQRPYTPLYLDANELKFFIRKYEEGPVSSYIH SKKEGDTIELRGPFKTTKLDCTKYPRIVAIVAGTGIAPIYQLAQSVKSPVDIVYCSRPGQ PPLLKEELEKECPNVRVKSVQNRLVNIHDILDWDNVTVPLKDTLCIVCGSQKFVSTIAGP KADYGARQGEVKGLLSNNPFGKVWKL
Protein Names:Recommended name: Uncharacterized FAD-binding protein C17H9.12c
Gene Names:ORF Names:SPAC17H9.12c
Expression Region:1-266
Sequence Info:full length protein
You may also like
-
Recombinant Schizosaccharomyces pombe Uncharacterized protein C17G6.02c (SPAC17G6.02c)
- Regular price
- €1.180,95 EUR
- Sale price
- €1.180,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Schizosaccharomyces pombe Uncharacterized TLC domain-containing protein C17A2.02c (SPAC17A2.02c)
- Regular price
- €1.155,95 EUR
- Sale price
- €1.155,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Schizosaccharomyces pombe UPF0494 membrane protein PB2B2.07c(SPBPB2B2.07c)
- Regular price
- €1.125,95 EUR
- Sale price
- €1.125,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Schizosaccharomyces pombe Uncharacterized protein PB17E12.11(SPAPB17E12.11)
- Regular price
- €1.155,95 EUR
- Sale price
- €1.155,95 EUR
- Regular price
-
- Unit price
- per
Sold out