Gene Bio Systems
Recombinant Schizosaccharomyces pombe Microsomal signal peptidase subunit 1(new19)
Recombinant Schizosaccharomyces pombe Microsomal signal peptidase subunit 1(new19)
SKU:CSB-CF518820SXV
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
Uniprot NO.:G2TRR4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNYLEGTIDFAGQLRCQKYMNYGLCTSAVISYIYGYLVQDSYCVIKLFLILASLVALVCL PAWSMYNKNPLKFQKKKE
Protein Names:Recommended name: Microsomal signal peptidase subunit 1 EC= 3.4.-.-
Gene Names:Name:new19 ORF Names:SPBC887.22
Expression Region:1-78
Sequence Info:full length protein
