Skip to product information
1 of 1

Gene Bio Systems

Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 106 protein(mug106)

Recombinant Schizosaccharomyces pombe Meiotically up-regulated gene 106 protein(mug106)

SKU:CSB-CF611977SXV

Regular price €1.362,95 EUR
Regular price Sale price €1.362,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:Q10493

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:YNHKFDCIVVTIYCGCLFWFSNGALFTEGKARDRGRWAKATMKKNYGVKLKIFLFTILLA FETNTFTPYTSTFSHFARGCL

Protein Names:Recommended name: Meiotically up-regulated gene 106 protein

Gene Names:Name:mug106 ORF Names:SPAC26F1.05

Expression Region:35-115

Sequence Info:full length protein

View full details