Gene Bio Systems
Recombinant Schizosaccharomyces japonicus Protein get1(get1)
Recombinant Schizosaccharomyces japonicus Protein get1(get1)
SKU:CSB-CF476031SXT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Schizosaccharomyces japonicus (strain yFS275 / FY16936) (Fission yeast)
Uniprot NO.:B6JZY9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDFLLFLFCLNLFIHLFDKYVKTFLVNQGFRVYARFSGSPEFKSYNDLRLQLLSTKRDLN NVSAQDEFAKWARLNRKFDQLNVKWEKQSKIVSQKSEGVKKLISLTFWIVTRGYRFIVQF KNSGNPVFAVPEGMLPTWALWFLALPKAKTGYVSVAVWNFASQKVISTLL
Protein Names:Recommended name: Protein get1 Alternative name(s): Guided entry of tail-anchored proteins 1
Gene Names:Name:get1 ORF Names:SJAG_01178
Expression Region:1-170
Sequence Info:full length protein
