
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Uniprot NO.:Q5PL71
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MINPNPKRSDEPVFWGLFGAGGMWGAIIAPVIVLLVGIMLPLGLFPGDALSFERVLTFTQ SFIGRVFLFLMIVLPLWCGLHRMHHAMHDLKIHVPAGKWVFYGLAAILTVVTAIGVITL
Protein Names:Recommended name: Fumarate reductase subunit D Alternative name(s): Fumarate reductase 13 kDa hydrophobic protein
Gene Names:Name:frdD Ordered Locus Names:SPA4157
Expression Region:1-119
Sequence Info:full length protein
You may also like
-
Recombinant Salmonella paratyphi A Fumarate reductase subunit D(frdD)
- Regular price
- €1.263,95 EUR
- Sale price
- €1.263,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Salmonella paratyphi C Fumarate reductase subunit D(frdD)
- Regular price
- €1.263,95 EUR
- Sale price
- €1.263,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Salmonella paratyphi B Fumarate reductase subunit D(frdD)
- Regular price
- €1.263,95 EUR
- Sale price
- €1.263,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Salmonella paratyphi A Fumarate reductase subunit C(frdC)
- Regular price
- €1.273,95 EUR
- Sale price
- €1.273,95 EUR
- Regular price
-
- Unit price
- per
Sold out