Skip to product information
1 of 1

Gene Bio Systems

Recombinant Salmonella choleraesuis Arginine exporter protein ArgO(argO)

Recombinant Salmonella choleraesuis Arginine exporter protein ArgO(argO)

SKU:CSB-CF685156SBF

Regular price €1.495,95 EUR
Regular price Sale price €1.495,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Salmonella choleraesuis (strain SC-B67)

Uniprot NO.:Q57K48

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MISYYFQGFALGAAMILPLGPQNAFVMNQGIRRQYHLMIALLCALSDLVLISAGIFGGSA LLMQSPWLLALVTWGGVAFLLWYGFGALKTAMSSNLELASAEVMKQGRWKIIATMLAVTW LNPHVYLDTFVVLGSLGGQLAMEPKRWFALGTISASFLWFFGLALLAAWLAPRLRTVKAQ RIINILVGVVMWLIAFQLAREGVAHMQALFN

Protein Names:Recommended name: Arginine exporter protein ArgO

Gene Names:Name:argO Ordered Locus Names:SCH_3008

Expression Region:1-211

Sequence Info:full length protein

View full details