Skip to product information
1 of 1

Gene Bio Systems

Recombinant Salmo trutta ATP synthase subunit a(mt-atp6)

Recombinant Salmo trutta ATP synthase subunit a(mt-atp6)

SKU:CSB-CF654297SWJ

Regular price €1.386,95 EUR
Regular price Sale price €1.386,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Salmo trutta (Brown trout)

Uniprot NO.:Q36967

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:RNQPTAALGHLLPEGTPVPLIPVLIIIETISLFIRPLALGVRLTANLTAGHLLIQLIATA AFVLLPMMPTVAILTSIVLFLLTLLEIAVAMIQAYVFVLLLSLYL

Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): F-ATPase protein 6

Gene Names:Name:mt-atp6 Synonyms:atp6, atpase6, mtatp6

Expression Region:1-105

Sequence Info:full length protein

View full details