Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharophagus degradans UPF0316 protein Sde_0566(Sde_0566)

Recombinant Saccharophagus degradans UPF0316 protein Sde_0566(Sde_0566)

SKU:CSB-CF635431SAAX

Regular price €1.468,95 EUR
Regular price Sale price €1.468,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)

Uniprot NO.:Q21N99

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNEWLNVAPELLALLIFVSRVIDVSLGTFRTIVIFRGYKALAAFIGFFEIMIWLVAAGQV FKNLDQWYLALAYAGGFSMGNYVGMWIENRFAIGNELVRCLSFNRDVLAEKIREQGFKVI SFDGDMGTDKLVELLFIVEKRRNVPALIKLIKELDASAVYSVSDVKSVYEGPEPLPRRLF FR

Protein Names:Recommended name: UPF0316 protein Sde_0566

Gene Names:Ordered Locus Names:Sde_0566

Expression Region:1-182

Sequence Info:full length protein

View full details