Recombinant Saccharomyces cerevisiae  V-type proton ATPase subunit c'(VMA16)

Recombinant Saccharomyces cerevisiae V-type proton ATPase subunit c'(VMA16)

CSB-CF338558SVG
Regular price
€1.088,95 EUR
Sale price
€1.088,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P23968

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNKESKDDDMSLGKFSFSHFLYYLVLIVVIVYGLYKLFTGHGSDINFGKFLLRTSPYMWA NLGIALCVGLSVVGAAWGIFITGSSMIGAGVRAPRITTKNLISIIFCEVVAIYGLIIAIV FSSKLTVATAENMYSKSNLYTGYSLFWAGITVGASNLICGIAVGITGATAAISDAADSAL FVKILVIEIFGSILGLLGLIVGLLMAGKASEFQ

Protein Names:Recommended name: V-type proton ATPase subunit c'' Short name= V-ATPase subunit c'' Alternative name(s): V-ATPase 22 kDa proteolipid subunit Vacuolar proton pump c'' subunit

Gene Names:Name:VMA16 Synonyms:PPA1 Ordered Locus Names:YHR026W

Expression Region:1-213

Sequence Info:full length protein

Your list is ready to share