Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Ribonuclease MRP protein subunit RMP1(RMP1)

Recombinant Saccharomyces cerevisiae Ribonuclease MRP protein subunit RMP1(RMP1)

SKU:CSB-CF621499SVG

Regular price €1.489,95 EUR
Regular price Sale price €1.489,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:Q12530

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDEMDNVIRSLEQEYRLILLLNHRNKNQHRAASWYGSFNEMKRNCGQIITLFSSRRLQAK RLKDVEWVKLHRLLQRALFRQLKRWYWQFNGVIALGQFVTLGCTLVTLLANVRALYMRLW EINETEFIRCGCLIKNLPRTKAKSVVNDVEELGEIIDEDIGNNVQENELVITSIPKPLTE NCKKKKKRKKKNKSAIDGIFG

Protein Names:Recommended name: Ribonuclease MRP protein subunit RMP1 Alternative name(s): RNA-processing protein RMP1 RNase MRP 23.6 kDa subunit

Gene Names:Name:RMP1 Ordered Locus Names:YLR145W

Expression Region:1-201

Sequence Info:full length protein

View full details