Skip to product information
1 of 1

Gene Bio Systems

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YOR329W-A (YOR329W-A)

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YOR329W-A (YOR329W-A)

SKU:CSB-CF313992SVG

Regular price €1.351,95 EUR
Regular price Sale price €1.351,95 EUR
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Uniprot NO.:P0C5R1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFRYHVKFIEPAMIYKILANEKMQIIWVLNSYFEFYLLFCPRFLMLTLFLIGATYFCFLI WRKKVSRNK

Protein Names:Recommended name: Putative uncharacterized protein YOR329W-A

Gene Names:Ordered Locus Names:YOR329W-A ORF Names:smORF626

Expression Region:1-69

Sequence Info:full length protein

View full details